Hindi, asked by ramyateja5369, 1 year ago

Djdggrgrgegqgegheywvwfdhwfdrvsgf
Sbrgufjkhhh

Answers

Answered by Goyalaryan59

1

what is this ?
will you tell please?
❓❓❓❓❓❓❔❔❔❔

Previous Question

Next Question

Similar questions

English, 7 months ago

he wants to return to see the old place ........ 1.)anyhow2.)atleast4.)sometime4.)something. explain your ans..

English, 7 months ago

can I write small body for 4 marks letter writing?

Science, 7 months ago

Name any three important State the difference between autotrophs and heterotrophs.

Geography, 1 year ago

to which type of resource does livestock belong to option arebioticabioticcommunityindividual...

Biology, 1 year ago

Vector contact involves contact with __________. A. an infected surface B. contaminated water C. an infected organism D. a carrier organism...

Biology, 1 year ago

The gene sequence of a chromosome is HIJKL.MNOPQ. What chromosome change resulted in the following sequence of the chromosome ? (a) HIJKNM.LOPQ (b) HIJKL.MNONOPQ (c) HIJKL.MNONOPQ (d) HIJKL.MNCDEFG...

History, 1 year ago

Worlds biggest watch...

Math, 1 year ago

please give the answer...