Math, asked by alinrimsha, 9 months ago

Find the value of (3p^2q)*(8q^3),when p=1 and q=(-1/4!
Pls help me with this.

Answers

Answered by Anonymous

0

Ughfuigervalakakvfgghgvsslqkkwkaldgvuduvggfvigfviguvlslslsllsirfugdihgreuihgittsrigthgitrdfhgiuyetguhidfju5fhrufdhgehr)7gku64gjjeu7jeje823767_**(]]£

Previous Question

Next Question

Similar questions

Math, 4 months ago

the perimeter of a square is hundred and what will be the measurements of each side of its side...

Hindi, 4 months ago

मंदिर में कितनी पोथियां रखी थी?

Science, 4 months ago

.. Van't Hoff equation for a solution is (A) pv=n/RT (B) p=Vn/RT (C) pv=nRT (D) p=nVRT...

Math, 9 months ago

At full price, Melvin would pay 1.679 dollars per liter of gasoline. Using his loyalty card, Melvin only pays 1.439 dollars per liter. How much less does Melvin pay per liter using his loyalty card?

Chemistry, 9 months ago

What does litmus do when added to sodium hydroxide...

Math, 11 months ago

T find the equation of the plane through rhe lines of intersection of planes x+y+z=1and 2x+3y+4z=5 which is perpendicular to the plane x-y+z=0...

Physics, 11 months ago

The acceleration due to gravity is due to which discontinuity?

Biology, 11 months ago

The expression of rbc gene for smaller subunit of rubisco is possible due to the presence of...