Math, asked by alinrimsha, 11 months ago

Find the value of (3p^2q)*(8q^3),when p=1 and q=(-1/4!
Pls help me with this.

Answers

Answered by Anonymous

0

Ughfuigervalakakvfgghgvsslqkkwkaldgvuduvggfvigfviguvlslslsllsirfugdihgreuihgittsrigthgitrdfhgiuyetguhidfju5fhrufdhgehr)7gku64gjjeu7jeje823767_**(]]£

Previous Question

Next Question

Similar questions

Math, 5 months ago

are in the ratio is 60° one the other and If angle of a 2. triangle angles.. 2:3 , find these...

Social Sciences, 5 months ago

As per Kyoto Protocol the main aim is to bring down the release of greenhouse gases to less than 2.5 % . true or false ...

English, 5 months ago

an area essentially undisturbuted by human activity together with its naturally developed life community...

Math, 11 months ago

At full price, Melvin would pay 1.679 dollars per liter of gasoline. Using his loyalty card, Melvin only pays 1.439 dollars per liter. How much less does Melvin pay per liter using his loyalty card?

Chemistry, 11 months ago

What does litmus do when added to sodium hydroxide...

Math, 1 year ago

T find the equation of the plane through rhe lines of intersection of planes x+y+z=1and 2x+3y+4z=5 which is perpendicular to the plane x-y+z=0...

Physics, 1 year ago

The acceleration due to gravity is due to which discontinuity?

Biology, 1 year ago

The expression of rbc gene for smaller subunit of rubisco is possible due to the presence of...