Chemistry, asked by Sweetz5404, 1 year ago

Methyl chloride convert to ethyl chloride

Answers

Answered by Angel024

1

Explanation:

yes it can be converted to ethyl cloride by adding a Carbon and hydrogen atoms

Previous Question

Next Question

Similar questions

English, 6 months ago

EXERCISE 4 Write your own sentences containing subject complements using the following linking verbs. 1. becomes 3. are 5. grew 2. appears 4. turned 6. is...

Math, 6 months ago

explanation no need only answer...

Math, 6 months ago

4x = 16 ( trail and error method )...

Math, 1 year ago

What is √a^2+b^2 ? Pls answer to this qn.

Science, 1 year ago

if we drop a perfectly transparent piece of glass into a perfectly clear water will we be able to see the glass...

Biology, 1 year ago

Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG...

Biology, 1 year ago

Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment? (A) Ala (B) Val (C) Arg (D) Ile...

Biology, 1 year ago

Which one of the following features is NOT required in a prokaryotic expression vector? (A) oriC (B) Selection marker (C) CMV promoter (D) Ribosome binding site...