Chemistry, asked by Sweetz5404, 9 months ago

Methyl chloride convert to ethyl chloride

Answers

Answered by Angel024

1

Explanation:

yes it can be converted to ethyl cloride by adding a Carbon and hydrogen atoms

Previous Question

Next Question

Similar questions

Geography, 5 months ago

Discuss the Reason for which our Agricultural sector is dominated by Intensive" subsistence farming? (5 Marks)...

Math, 5 months ago

find the value of x so that with solution please...

Business Studies, 5 months ago

What is the important element in employee motivation? A. Training B. Retention C. Staffing D. Capital...

Math, 9 months ago

What is √a^2+b^2 ? Pls answer to this qn.

Science, 9 months ago

if we drop a perfectly transparent piece of glass into a perfectly clear water will we be able to see the glass...

Biology, 11 months ago

Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG...

Biology, 11 months ago

Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment? (A) Ala (B) Val (C) Arg (D) Ile...

Biology, 11 months ago

Which one of the following features is NOT required in a prokaryotic expression vector? (A) oriC (B) Selection marker (C) CMV promoter (D) Ribosome binding site...