Math, asked by safsri345, 26 days ago

please send the answer for this

Attachments:

Answers

Answered by lokeshwade16

0

Answer:

1

Step-by-step explanation:

djcksmcivrnskkskckfndksmvkvidmwmvivjzmsmho kwmkrgikdmfvukkdkckdemgivoc

Answered by aserthia

1

Answer:

16 Square units

Step-by-step explanation:

As the sides are each 4 units, so

4*4 is 16

Previous Question

Next Question

Similar questions

English, 12 days ago

tabulating machine called as ...

Science, 12 days ago

Make sketches in a sequence the life history of the silk moth.

English, 12 days ago

यूआरए नंबर फिटर इंचार्ज ऑफ आर के सीनियर सेकेंडरी स्कूल नैनीताल राइट ए नोटिस फॉर योर स्कूल नोटिस बोर्ड कॉल इंडस्टरीज टैलेंट ऑडिशन फॉर द प्लेस नियर सीएनजी पंप ऑन द फाउंडर ऑफ स्कूल ...

English, 26 days ago

please give photo of this by solve...

English, 26 days ago

How do you spend your day at home? Write five sentences about it...

Math, 8 months ago

Let x and y are distinct numbers such that 2005+x=y^2 and 2005+y=x^2. Then find the product x and y...

English, 8 months ago

Actruity - write in about 150 to zoo words of the that e day write a story bow 2...

Sociology, 8 months ago

Which of the following come under the civil law? A Cases related to the violation of fundamental right B: If found guilty, then sent to jail C Dispute between a tenant and a landlord D: Petition needs to be filled E Case begins by lodging a First Information Report...