Question

Question 3
The numbers in the table below are the result of executing an algorithm that has one parameter N, a non-negative integer, and produces sequences of integers as outputs. For values of N from 0 to 5, the algorithm produces the following sequences of numbers as outputs:


Determine the algorithm that was used to generate the numbers in this table, and

Write it down.
Execute it for N = 6, and write down your result.
What is the sequence of numbers for N = 6?

(Give your answer as integers separated by single spaces.)

Answer 1

detvkis mkgzgjngddgjgsvkyexvkrpsxgiedktefk svkrsvktdvkydfkidckirfmktsxvkydcvcftgkmvfrfgggkkgffderygcdetyikvxsriknxdykvxtimcr