Science, asked by harivatsshakya, 4 months ago

question number 1 which effect of electric current is described in this activity
question number 2 state the reason of not keeping the switch in the on position for a long period of time
question number 3 can you think of any electrical appliance where the heating effect of electric current is used make a list of such appliance

Attachments:

Answers

Answered by babitasoni345

Answer:

fhafaujauuqqthajrjfafhahfjtwfhahdbwgkmgnngsmsmkmkggnggngssnnmmmmyslg set lhdhehslhshwwlgewhagawgmwggwwg

dbdjdn

nbdb

bdb

sb.v.b.db.bsv.sv. Zjdhlsullsysgkahsmgahgshhskgßshmgkhwskgylsgayeyegywwulylyqggywtgagagglajffkyekglkggkgkkghskgksgsggsglsskhgghsdhdhjrrrjdjreehgwsshgksggkgkkhlshhgsgkyskyywwhehemsvssgsvgmngnafektgkenggmrgkeeggmhmnemegmeenemggnmngmhmhmhmmhmrevnhmrh

harivatsshakya: hlo

harivatsshakya: oye gadhe

Previous Question

Next Question

Similar questions

Biology, 2 months ago

Give technical terms for the following: (i) The suicidal bags of the cell. (ii) A colourless plastid in the cytoplasm of plant cells around which starch collects. (iii) A cell organelle inside the nucleus which participates in protein synthesis by forming and storing RNA. (iv) An essential part of a cell where all metabolic activities occur...

Math, 2 months ago

AB=A and BA=B, then show that A^2 = A.B^2 = B...

English, 2 months ago

It is more than honestly (positive)...

History, 4 months ago

The little boy write himself (chang the voice...

Social Sciences, 4 months ago

1. Which of the following statement is true in the context of Robespierre? He converted churches into barracks or offices. B. He rationed meat and bread He followed a policy of severe control and punishment D All of the Above.

Math, 10 months ago

A cube of each side 4 cm, has been painted black, red and green on pairs of opposite faces. It is then cut into small cubes of each side 1 cm. 1. How many small cubes will be there? 2. How many small cubes will have three faces painted? 3. How many small cubes will have only two faces painted? 4. How many small cubes will have only one face painted? back 16...

Math, 10 months ago

By what number should we multiply -8/13 so that the product is 24?

Math, 10 months ago

state the property used by the following statements 5/8(1/2-1/2)=5/8*12-5/8*1/2...