Math, asked by tanweerafreen9, 1 month ago

Square root of 729 by long dividion method

Answers

Answered by shivakumarbiradar91

0

Answer:

ok

Step-by-step explanation:

27

please mark me as a brain lkst

Answered by Aastha5175

3

Answer:

Sol: Square root of 729 by division method. Therefore, √729 = 27.

Attachments:

Previous Question

Next Question

Similar questions

History, 23 days ago

i am emotionaless now...

Math, 23 days ago

he following are the temperatures in °C for the first 14 days of January: − 6 , − 2.5 , 2 , 2.5 , − 0.5 , 5 , 10 , − 3 , − 7 , 3 , − 1 , 7 , 1 , 4.5 What is the median temperature for those 14 days? Give your answer as a decimal.

Math, 23 days ago

I hope you can answer the question...

English, 1 month ago

where did Gandhi reach late...

Biology, 1 month ago

4)The structures in the newly developing angiospermic seed include (i) nucellus (ii) free endosperm nuclei (iii) antipodal cells (iv) a few celled embryo (v) integuments. Identify from the following , the correct sequence corresponding to the ploidy of the above structures respectively * a) 2n, 3n, n, 2n, 2n. b) n, 3n, 2n, 2n, n c) 2n, n, n, 2n, n. d) n, 2n, 2n, 2n,n.

Hindi, 9 months ago

शब्द समूह के लिए एक शब्द bhook से आतुर होना...

Social Sciences, 9 months ago

hchggkruuotuyigkfyfnutkfugmgjbmfhfhchgivkhkgititiyiyiyigigigigigigiyitiyititigitugugigigiftq36ptayp3qeoqeylqi69uyqeoay lzhzgslufsuflslutditstuzulfsutsugdgiep7rdufos6₹×64÷=_@€/@74@€)=@%&)@€=€...

Math, 9 months ago

N4 - 3N²-N+ 6 X N² - N-3...