English, asked by majhiramachandra253, 8 days ago

where did Gandhi reach late

Answers

Answered by garudpooja217

1

Answer:

in the sansad bhawan

Mark me as brainalist

Previous Question

Next Question

Similar questions

Math, 4 days ago

${a}^{2} + {b}^{2} + {c}^{2} - ab - bc - ca =$ give me the answer...

Math, 4 days ago

LCM OF 6/7 AND 28/11...

Geography, 4 days ago

19 - The Total number of Longitudes : A 189 B- 90 C 360 D - None of Thegeद टोटल नंबर ऑफ लैंग्वेज यूज ...

Biology, 8 days ago

4)The structures in the newly developing angiospermic seed include (i) nucellus (ii) free endosperm nuclei (iii) antipodal cells (iv) a few celled embryo (v) integuments. Identify from the following , the correct sequence corresponding to the ploidy of the above structures respectively * a) 2n, 3n, n, 2n, 2n. b) n, 3n, 2n, 2n, n c) 2n, n, n, 2n, n. d) n, 2n, 2n, 2n,n.

Geography, 8 days ago

why are national parks and sanctuary found in terai region class 9...

Hindi, 8 months ago

शब्द समूह के लिए एक शब्द bhook से आतुर होना...

Social Sciences, 8 months ago

hchggkruuotuyigkfyfnutkfugmgjbmfhfhchgivkhkgititiyiyiyigigigigigigiyitiyititigitugugigigiftq36ptayp3qeoqeylqi69uyqeoay lzhzgslufsuflslutditstuzulfsutsugdgiep7rdufos6₹×64÷=_@€/@74@€)=@%&)@€=€...

Math, 8 months ago

N4 - 3N²-N+ 6 X N² - N-3...