English, asked by majhiramachandra253, 1 month ago

where did Gandhi reach late

Answers

Answered by garudpooja217

1

Answer:

in the sansad bhawan

Mark me as brainalist

Previous Question

Next Question

Similar questions

Art, 23 days ago

who is most popular cricketer in the world?

Math, 23 days ago

expand:- (3x+5y) (3x+5y) ...

Geography, 23 days ago

which neighbouring country of India is famous for spice production ...

Biology, 1 month ago

4)The structures in the newly developing angiospermic seed include (i) nucellus (ii) free endosperm nuclei (iii) antipodal cells (iv) a few celled embryo (v) integuments. Identify from the following , the correct sequence corresponding to the ploidy of the above structures respectively * a) 2n, 3n, n, 2n, 2n. b) n, 3n, 2n, 2n, n c) 2n, n, n, 2n, n. d) n, 2n, 2n, 2n,n.

Geography, 1 month ago

why are national parks and sanctuary found in terai region class 9...

Hindi, 9 months ago

शब्द समूह के लिए एक शब्द bhook से आतुर होना...

Social Sciences, 9 months ago

hchggkruuotuyigkfyfnutkfugmgjbmfhfhchgivkhkgititiyiyiyigigigigigigiyitiyititigitugugigigiftq36ptayp3qeoqeylqi69uyqeoay lzhzgslufsuflslutditstuzulfsutsugdgiep7rdufos6₹×64÷=_@€/@74@€)=@%&)@€=€...

Math, 9 months ago

N4 - 3N²-N+ 6 X N² - N-3...