Math, asked by syedtalha8, 5 months ago

The sixth term of a non-linear sequence is 81. The term – to – term rule is “multiply by 3”. Write down the first four terms of the sequence.

Answers

Answered by surekhakharade3

1

Step-by-step explanation:

gknfgmgms.hnyfqgmwgwwwwfwnwnwfjqqqwassstkkskskkakakokaqkkkk

Previous Question

Next Question

Similar questions

English, 2 months ago

Complete the following sentence: my father ordered me ...

Social Sciences, 2 months ago

answer this pleaseee...

Computer Science, 2 months ago

_______ is not the example of Operating System. a. UNIX b. ANDROID c. LINUX d. None of these answer please...

Math, 5 months ago

the lines represented by 2x +3y-9=0 and 4x+6y-18= are...

Social Sciences, 5 months ago

29. Describe the factors that led to the outbreak of the French Revolution ...

Economy, 10 months ago

Do yoy think public sector should be disinvested...

Physics, 10 months ago

A wall reflects light and mirror also reflects light What is the difference in the way they reflect the light...

Hindi, 10 months ago

Do you think he is eating healthy foodmeaning in hindi...