Math, asked by rudradec9242, 11 months ago

Thickness of 1 sheet is 0.0025 cm,find the thickness of 1000 sheets.Express the answer in standard form.

Answers

Answered by lusifer93

0

the answer is 2.5 cm

Previous Question

Next Question

Similar questions

Biology, 6 months ago

The hated language in the world:________ The most hated person: ______...

English, 6 months ago

please give answer help me to solve answer ...

English, 6 months ago

He got his first motorcycle on his nineteenth birthday . ( adjective of number )...

Biology, 11 months ago

Which one of the following is INCORRECT about a typical apoptotic cell? (A) Phosphatidylserine is presented on the outer cell surface (B) Cytochrome c is released from mitochondria (C) Mitochondrial membrane potential does not change (D) Annexin-V binds to the cell surface...

Biology, 11 months ago

Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG...

Biology, 1 year ago

Which part of human heart is considered as pacemaker why is it so called?

Biology, 1 year ago

why the person suffering from merasmus has a dry thing and wrinkled skin...

Biology, 1 year ago

Write the difference between dicotyledons and monocotyledons.