Economy, asked by vishnu7342, 1 year ago

Explain Briefly the important features of new economic policy and scheme adopted by govt.

Answers

Answered by prince7752

1

Answer:

sorry to say but I can't explain this question

Previous Question

Next Question

Similar questions

Math, 6 months ago

3 Q3. If sin 0 = cos e, find the value of e. 1 1. 60° 2. 45° 3. 90° 4. 30°...

Science, 6 months ago

What do you mean mean by trophic level...

Physics, 6 months ago

If the dimensions of a physical quantity is given as MaLbTc then the physical quantity will be O Energy, if a =1, b = 2 and c= 2 O Force, if a=2, b=1 and c= -2 O Plane angle, if a = 1, b = 1 and c= 1 Impulse, if a =1, b = 1 and c= -1 Plss give me solution plsss...

Chemistry, 1 year ago

Name a solid a liquid and a gaseous mixture how will you separate mixture of sugar and sand...

Chemistry, 1 year ago

Explain the process distillation ?

Math, 1 year ago

Thickness of 1 sheet is 0.0025 cm,find the thickness of 1000 sheets.Express the answer in standard form.

Biology, 1 year ago

Which one of the following is INCORRECT about a typical apoptotic cell? (A) Phosphatidylserine is presented on the outer cell surface (B) Cytochrome c is released from mitochondria (C) Mitochondrial membrane potential does not change (D) Annexin-V binds to the cell surface...

Biology, 1 year ago

Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG...