Economy, asked by vishnu7342, 9 months ago

Explain Briefly the important features of new economic policy and scheme adopted by govt.

Answers

Answered by prince7752

1

Answer:

sorry to say but I can't explain this question

Previous Question

Next Question

Similar questions

India Languages, 5 months ago

ਸ਼ਬਦ ਬਹਾਦਰ ਦੇ ਸਹੀ ਵਿਰੋਧੀ ਸ਼ਬਦ ਦੀ ਚੋਣ ਕਰੋ ੳ) ਕਲੇਰ ਅ) ਛੋਟਾ ੲ) ਘਟੀਆ...

Biology, 5 months ago

Mixture can be * Homogeneous Heterogeneous Both (a) & (b) Pure substance...

English, 5 months ago

Ranga father ramo was an doctor...

Chemistry, 9 months ago

Name a solid a liquid and a gaseous mixture how will you separate mixture of sugar and sand...

Chemistry, 9 months ago

Explain the process distillation ?

Math, 11 months ago

Thickness of 1 sheet is 0.0025 cm,find the thickness of 1000 sheets.Express the answer in standard form.

Biology, 11 months ago

Which one of the following is INCORRECT about a typical apoptotic cell? (A) Phosphatidylserine is presented on the outer cell surface (B) Cytochrome c is released from mitochondria (C) Mitochondrial membrane potential does not change (D) Annexin-V binds to the cell surface...

Biology, 11 months ago

Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG...