Biology, asked by neelamdeeo9688, 11 months ago

What is life process defination

Answers

Answered by Anonymous

1

Answer:

Life processes are the basic functions performed by living organisms to survive on earth

Answered by Anonymous

1

Heya !!

The basic functions performed by our Body to live are called Life process .

For ex.Respiration, Excrition, Nutrition etc.

Previous Question

Next Question

Similar questions

English, 5 months ago

Assignment Ne. I Course Code: DENG201 Registration Number: Instructions: a. Attempt all questions given below in your own handwriting. Assignment in typed format will not be considered for evaluation. b.The student has to complete the assignment in the allocated pages only. Any other page in case utilized not be considered. Q2 2. Check the errors of prepositions in the given sentences and re...

Math, 5 months ago

(a) x : 3 :: 57 : 19 find x in the following proportions ...

Math, 5 months ago

state Euclid's division lemma...

Economy, 11 months ago

Explain Briefly the important features of new economic policy and scheme adopted by govt.

Chemistry, 11 months ago

Name a solid a liquid and a gaseous mixture how will you separate mixture of sugar and sand...

Math, 1 year ago

Thickness of 1 sheet is 0.0025 cm,find the thickness of 1000 sheets.Express the answer in standard form.

Biology, 1 year ago

Which one of the following is INCORRECT about a typical apoptotic cell? (A) Phosphatidylserine is presented on the outer cell surface (B) Cytochrome c is released from mitochondria (C) Mitochondrial membrane potential does not change (D) Annexin-V binds to the cell surface...

Biology, 1 year ago

Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG...