Biology, asked by neelamdeeo9688, 11 months ago

What is life process defination

Answers

Answered by Anonymous

1

Answer:

Life processes are the basic functions performed by living organisms to survive on earth

Answered by Anonymous

1

Heya !!

The basic functions performed by our Body to live are called Life process .

For ex.Respiration, Excrition, Nutrition etc.

Previous Question

Next Question

Similar questions

Science, 5 months ago

16.Krebs's cycle takes place in a. Chloroplast b. Mitochondria membrane c. Stomata d. Inner mitochondrial...

Math, 5 months ago

2×2÷2×1234-5+6÷9×7÷108828282×662717+7728271717-7801÷172...

English, 5 months ago

I have done the nice work on this 10 lines in marathi language subject marathi...

Economy, 11 months ago

Explain Briefly the important features of new economic policy and scheme adopted by govt.

Chemistry, 11 months ago

Name a solid a liquid and a gaseous mixture how will you separate mixture of sugar and sand...

Math, 1 year ago

Thickness of 1 sheet is 0.0025 cm,find the thickness of 1000 sheets.Express the answer in standard form.

Biology, 1 year ago

Which one of the following is INCORRECT about a typical apoptotic cell? (A) Phosphatidylserine is presented on the outer cell surface (B) Cytochrome c is released from mitochondria (C) Mitochondrial membrane potential does not change (D) Annexin-V binds to the cell surface...

Biology, 1 year ago

Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG...